Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G143700.1.p
Common NameGLYMA_09G143700, LOC100820113
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 777aa    MW: 85098.7 Da    PI: 5.552
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G143700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          ++k +++t++q++eLe++F+++++p++++r++L+k+lgL+ +qVk+WFqNrR+++k
                          79999************************************************999 PP

                START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                          la+ a++el+k+a+ +  +W kss    e +n de+ + f++  +     + +ea r +gvv++ +   ve+l+d+  +W e++     +
                          6789********************9999999*********99666999*****************************.9****999999* PP

                START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh 161
                          a+tlev+ssg      galq+m ae q+lsplvp R   f+Ry++q+g+g+w++vdvSvd  +++++s++++ +++lpSg++i++++ng 
                          ****************************************************************************************** PP

                START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                          sk+twveh  ++++++h+l+r+lv+sg+ +ga++w atl rqc 
                          *****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.96186146IPR001356Homeobox domain
SMARTSM003892.5E-1988150IPR001356Homeobox domain
PfamPF000461.9E-1989144IPR001356Homeobox domain
CDDcd000864.53E-1893146No hitNo description
PROSITE patternPS000270121144IPR017970Homeobox, conserved site
PROSITE profilePS5084844.133291527IPR002913START domain
SuperFamilySSF559611.18E-33293524No hitNo description
CDDcd088751.08E-109295522No hitNo description
SMARTSM002343.3E-38300524IPR002913START domain
PfamPF018522.5E-46301523IPR002913START domain
SuperFamilySSF559612.89E-17543745No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 777 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006587344.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLK7LDX20.0K7LDX2_SOYBN; Uncharacterized protein
STRINGGLYMA09G26600.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein